DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and RGD1560554

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_038959853.1 Gene:RGD1560554 / 502576 RGDID:1560554 Length:364 Species:Rattus norvegicus


Alignment Length:309 Identity:73/309 - (23%)
Similarity:109/309 - (35%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   993 SPDSMSKSVGNNHRSSQLGQRLYRDENRARPHSWAMTRSTGNTLQNFTNSVDNIR--------SL 1049
            |.|..:|..|..|.|.|  :..|:         |        |:.||:..:|.||        ||
  Rat     2 SGDLEAKISGYTHISVQ--RFCYK---------W--------TISNFSFCMDGIRENITSPVFSL 47

  Fly  1050 S---------RLFPNFSKEFS----------NSLPNGMTLEQV-------QGQ--QVDYIQTDLS 1086
            .         |:|||...|.|          :|.|....|.:|       ||:  |:..|...||
  Rat    48 EGNEEVQWCLRIFPNGVDEESKDYLSVSLGLHSCPKSPVLAKVQFWIINAQGEKHQIKEIPNILS 112

  Fly  1087 AD-----------------------------------SSLASSFSRSGMDESSLSCRQPRR-LGE 1115
            ..                                   |.:..|||..|.:.:..: :.||: |.:
  Rat   113 FSPKHQWGLRKFILREFLLSRRHGLLPEDQLILCCKVSVVGPSFSTPGHNMTPTN-KDPRQELAD 176

  Fly  1116 DLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHF 1177
            |:.:::...:.||..:.|.|:..||||.||.:|...|.||......:|:   :.:..........
  Rat   177 DIGELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLQVFKE 241

  Fly  1178 ALCHIYSG-ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN 1225
            .:..||:| |.|........||.|.||:..|:.||.:...:|    |.|
  Rat   242 MMAFIYTGKAPHLHSHSMATELLAAADMYDLQDLKVMCEDSL----CRN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 17/70 (24%)
BTB 1128..>1191 CDD:197585 19/66 (29%)
BACK 1238..>1281 CDD:197943
RGD1560554XP_038959853.1 MATH 16..153 CDD:351761 29/155 (19%)
BTB_POZ 165..292 CDD:365784 35/127 (28%)
BACK 287..352 CDD:421692 73/309 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.