Sequence 1: | NP_001189017.1 | Gene: | CG13917 / 38186 | FlyBaseID: | FBgn0035237 | Length: | 2019 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038959853.1 | Gene: | RGD1560554 / 502576 | RGDID: | 1560554 | Length: | 364 | Species: | Rattus norvegicus |
Alignment Length: | 309 | Identity: | 73/309 - (23%) |
---|---|---|---|
Similarity: | 109/309 - (35%) | Gaps: | 100/309 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 993 SPDSMSKSVGNNHRSSQLGQRLYRDENRARPHSWAMTRSTGNTLQNFTNSVDNIR--------SL 1049
Fly 1050 S---------RLFPNFSKEFS----------NSLPNGMTLEQV-------QGQ--QVDYIQTDLS 1086
Fly 1087 AD-----------------------------------SSLASSFSRSGMDESSLSCRQPRR-LGE 1115
Fly 1116 DLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHF 1177
Fly 1178 ALCHIYSG-ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN 1225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13917 | NP_001189017.1 | BTB | 1117..>1185 | CDD:279045 | 17/70 (24%) |
BTB | 1128..>1191 | CDD:197585 | 19/66 (29%) | ||
BACK | 1238..>1281 | CDD:197943 | |||
RGD1560554 | XP_038959853.1 | MATH | 16..153 | CDD:351761 | 29/155 (19%) |
BTB_POZ | 165..292 | CDD:365784 | 35/127 (28%) | ||
BACK | 287..352 | CDD:421692 | 73/309 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |