DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and RGD1564313

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_003749379.1 Gene:RGD1564313 / 502566 RGDID:1564313 Length:364 Species:Rattus norvegicus


Alignment Length:307 Identity:69/307 - (22%)
Similarity:110/307 - (35%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 TLSN-GHTMESLHATIEKQKQLLETVNEHGEQTTQQPSQIPSSFVKLSDMDKPVKHDLQSPDSMS 998
            |:|| ...|:.:..:|......||...|.....|..|:.:                |.:|.|.:|
  Rat    25 TISNFSFCMDGIQESITSPVFSLEANEEVQWCLTIYPNGV----------------DEESKDYLS 73

  Fly   999 KSVGNNH--RSSQLGQRLYRDENRARPHSWAMTRSTGNTLQNFTNSVDNIRSLSRLFPN------ 1055
            ..:|.:.  :|..|          |:...| :|.:.|...|     :..||::.|..||      
  Rat    74 VCLGLHSCPKSPVL----------AKFQCW-ITNAQGEKHQ-----ITEIRNVIRFLPNEQWALR 122

  Fly  1056 --FSKEFSNSLPNGMTLEQVQGQQVDYIQTDLSADSSLAS-SFSRSGMDESSLSCRQPRRLGEDL 1117
              ..::|..|..:.:..|.         |..|....|:.. |.||.|...........:.|.:|:
  Rat   123 KFILRDFLLSHRHWLLPED---------QLILCCKVSIVGPSLSRPGHSMRPEIKDPTQMLADDV 178

  Fly  1118 LKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHFAL 1179
            .:::...:.||..:.|.|:..||||.||.:|...|.||......:|:   :.:...........:
  Rat   179 GELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLQVFKEMM 243

  Fly  1180 CHIYSG-ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN 1225
            ..||:| |.|.........|.|.||...|:.||.:...:|    |.|
  Rat   244 AFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSL----CRN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 17/70 (24%)
BTB 1128..>1191 CDD:197585 19/66 (29%)
BACK 1238..>1281 CDD:197943
RGD1564313XP_003749379.1 MATH 16..153 CDD:295307 33/168 (20%)
BTB 180..284 CDD:279045 28/107 (26%)
BTB 189..287 CDD:197585 29/102 (28%)
SPOP_C 287..348 CDD:269807 69/307 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.