DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and klhl21

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_001307336.1 Gene:klhl21 / 404613 ZFINID:ZDB-GENE-040426-2627 Length:613 Species:Danio rerio


Alignment Length:329 Identity:64/329 - (19%)
Similarity:107/329 - (32%) Gaps:117/329 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1128 DMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHFALCHIYSG---A 1186
            |:.:...|:....|:.:|.:...||.||.||...:||   |.|...|...:...:...|:|   .
Zfish    39 DVTLCAEGKEFHCHRTVLAAASMYFRAMFAGTLRESVMDRVVLHEVSAELLGLLVDFCYTGRVTV 103

  Fly  1187 SHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHNFHKPCSGCSDGILQVLPVALNHALDD 1251
            :|  |.:.|  |...|||.....:||.....|:...      ..|.|    |::...|..:|..:
Zfish   104 TH--DNVDL--LLKTADLFQFPSVKEACCAFLEQRL------DVSNC----LEIQDFAEAYACRE 154

  Fly  1252 L----------------------------------------------YRKCLRWT---CRHYLKV 1267
            |                                              |:..:||.   .:|.|..
Zfish   155 LAASARRFVLKNIVELAKSMDFERLSWKRLLEFVSDDGLCVDKEETAYQIAVRWVKADLQHRLHY 219

  Fly  1268 WP-TRQFAQLPPDILGRCRQQIVAYMTSDTVLDTVLDCDHLLAQLSAY---------RWGH---- 1318
            || ..|..:||   ..| |..::|::.||.::.....|..|:::..::         |.||    
Zfish   220 WPELLQQVRLP---FVR-RFYLLAHVESDPLVYLSPACLRLVSEARSFQSYEYDRHDRPGHRMRP 280

  Fly  1319 ------------------VCEQLV------------REILEAAYAYVGDHFASLIASDSFLSLGH 1353
                              .|::||            |.:.|......|.:..:.:.:|.:::.|.
Zfish   281 RPSTGLAEILVVVGGCDQDCDELVTVDCYNPQTGQWRYLAEFPDHLGGGYSIAALGNDIYVTGGS 345

  Fly  1354 DRSR 1357
            |.||
Zfish   346 DGSR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 16/59 (27%)
BTB 1128..>1191 CDD:197585 18/68 (26%)
BACK 1238..>1281 CDD:197943 14/92 (15%)
klhl21NP_001307336.1 BTB 35..549 CDD:333434 64/329 (19%)
Kelch 1 289..337 6/47 (13%)
KELCH repeat 328..370 CDD:276965 6/22 (27%)
Kelch 2 338..384 5/12 (42%)
KELCH repeat 374..411 CDD:276965
Kelch 3 386..424
KELCH repeat 414..455 CDD:276965
Kelch 4 426..472
Kelch 5 474..514
KELCH repeat 504..550 CDD:276965
Kelch 6 515..562
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.