Sequence 1: | NP_001189017.1 | Gene: | CG13917 / 38186 | FlyBaseID: | FBgn0035237 | Length: | 2019 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001307336.1 | Gene: | klhl21 / 404613 | ZFINID: | ZDB-GENE-040426-2627 | Length: | 613 | Species: | Danio rerio |
Alignment Length: | 329 | Identity: | 64/329 - (19%) |
---|---|---|---|
Similarity: | 107/329 - (32%) | Gaps: | 117/329 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1128 DMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHFALCHIYSG---A 1186
Fly 1187 SHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHNFHKPCSGCSDGILQVLPVALNHALDD 1251
Fly 1252 L----------------------------------------------YRKCLRWT---CRHYLKV 1267
Fly 1268 WP-TRQFAQLPPDILGRCRQQIVAYMTSDTVLDTVLDCDHLLAQLSAY---------RWGH---- 1318
Fly 1319 ------------------VCEQLV------------REILEAAYAYVGDHFASLIASDSFLSLGH 1353
Fly 1354 DRSR 1357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13917 | NP_001189017.1 | BTB | 1117..>1185 | CDD:279045 | 16/59 (27%) |
BTB | 1128..>1191 | CDD:197585 | 18/68 (26%) | ||
BACK | 1238..>1281 | CDD:197943 | 14/92 (15%) | ||
klhl21 | NP_001307336.1 | BTB | 35..549 | CDD:333434 | 64/329 (19%) |
Kelch 1 | 289..337 | 6/47 (13%) | |||
KELCH repeat | 328..370 | CDD:276965 | 6/22 (27%) | ||
Kelch 2 | 338..384 | 5/12 (42%) | |||
KELCH repeat | 374..411 | CDD:276965 | |||
Kelch 3 | 386..424 | ||||
KELCH repeat | 414..455 | CDD:276965 | |||
Kelch 4 | 426..472 | ||||
Kelch 5 | 474..514 | ||||
KELCH repeat | 504..550 | CDD:276965 | |||
Kelch 6 | 515..562 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |