DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and klhl7

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_957171.1 Gene:klhl7 / 393851 ZFINID:ZDB-GENE-130212-1 Length:538 Species:Danio rerio


Alignment Length:270 Identity:57/270 - (21%)
Similarity:105/270 - (38%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1102 ESSLSCRQPRRLGEDLL----KMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAG---H 1159
            |..::.::..||..:::    .:..|.|..|:::.|.|:.|.||:.:|.:...:|:.|...   .
Zfish    17 EKKIASKEEYRLLSNIMGVMNNLRKQGILCDVILVVEGKHILAHRVVLSAASHFFSLMFTSSMME 81

  Fly  1160 GSQSVVSLQGYSYAAVHFALCHIYSGASHPPDGISLMELAALADLLGLEGLKEVTAHALK----- 1219
            .|...|.|.|.....:...:..||: |....:..::..|...|:...::.:|::....||     
Zfish    82 ASNHEVELGGAEPEIIELLVEFIYT-ARISVNSNNVQSLLNAANQYQIDPVKKMCVDFLKEQVDA 145

  Fly  1220 TNYCHNFH--KPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDILG 1282
            || |....  ..|..|.:         |..|.||...       :|:..|:...:|.||  |:  
Zfish   146 TN-CLGISALAECLNCPE---------LKVAADDFIH-------QHFTNVYKMDEFLQL--DV-- 189

  Fly  1283 RCRQQIVAYMTSDTVL----DTVLDCDHLLAQLSAYRWGHVCEQLVREILEAAYAYVGDHFASL- 1342
               :|:...:..||:.    |.:.|        :|.||      |..::|...: |:.|....: 
Zfish   190 ---KQVTHLLQQDTLTVRAEDQIYD--------AAVRW------LKYDVLNRQH-YIVDILGKVR 236

  Fly  1343 --IASDSFLS 1350
              :.|.:|||
Zfish   237 FPLVSKNFLS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 17/74 (23%)
BTB 1128..>1191 CDD:197585 16/65 (25%)
BACK 1238..>1281 CDD:197943 10/42 (24%)
klhl7NP_957171.1 BTB 36..140 CDD:279045 21/104 (20%)
PHA03098 41..538 CDD:222983 54/246 (22%)
BACK 148..250 CDD:285009 29/137 (21%)
KELCH repeat 328..370 CDD:276965
KELCH repeat 374..418 CDD:276965
Kelch 385..432 CDD:128874
KELCH repeat 422..470 CDD:276965
Kelch 433..482 CDD:128874
Kelch_1 472..517 CDD:279660
KELCH repeat 473..517 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.