DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and rcbtb1

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_956285.1 Gene:rcbtb1 / 336007 ZFINID:ZDB-GENE-030131-7951 Length:531 Species:Danio rerio


Alignment Length:187 Identity:45/187 - (24%)
Similarity:79/187 - (42%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1113 LGEDLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQ---SVVSLQGYSYAA 1174
            :.:.|.|.|.....:|:...:.|:.|..||.:|:.||::|.:|...|.::   .|:.:..:||..
Zfish   356 VAQSLKKEFDNPETSDLEFSIDGKYIHVHKAVLKIRCEHFRSMFQSHWNEDMKEVIEIDQFSYPV 420

  Fly  1175 VHFALCHIYSGASH--PPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN-FHKPCS----- 1231
            ....|..:|:.:..  |.|.|.|::||                    |:||.| ..|.|.     
Zfish   421 YRSFLEFLYTDSVDLPPEDAIGLLDLA--------------------TSYCENRLKKLCQHIIKR 465

  Fly  1232 GCS-DGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDILGR--CR 1285
            |.: :....:|..|:.:..:||...|.::...|..:|..|..|.|:..::|..  ||
Zfish   466 GITVENAFSLLSAAIRYDAEDLEEFCFKFCVNHLTEVTQTAAFWQIDGNMLKEFICR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 19/70 (27%)
BTB 1128..>1191 CDD:197585 17/67 (25%)
BACK 1238..>1281 CDD:197943 10/42 (24%)
rcbtb1NP_956285.1 RCC1 40..90 CDD:278826
RCC1_2 77..106 CDD:290274
RCC1 93..143 CDD:278826
RCC1 146..196 CDD:278826
RCC1 199..248 CDD:278826
RCC1 251..299 CDD:278826
BTB 360..464 CDD:279045 31/123 (25%)
BTB 371..467 CDD:197585 28/115 (24%)
SPOP_C_like 467..525 CDD:269810 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.