DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and RGD1566337

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:358 Identity:79/358 - (22%)
Similarity:121/358 - (33%) Gaps:114/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   993 SPDSMSKSVGNNHRSSQLGQRLYRDENRARPHSWAMTRSTGNTLQNFTNSVDNIRS--------- 1048
            |.|..:||.|..|.|.|         |..  :.|        |:.||:..:|.||.         
  Rat     2 SGDLEAKSYGYTHSSVQ---------NFC--YEW--------TISNFSFCMDGIRENIASPVFSF 47

  Fly  1049 --------LSRLFPN-FSKEFSN---------SLPNGMTLEQV-------QGQ------------ 1076
                    ..|:.|| |.:|..:         |.|:...|.:|       ||:            
  Rat    48 EANEEVEWCLRIHPNGFDEESKDYLSVYLWLLSCPDSPVLAKVQFWIINAQGEKHQISKMPNVLR 112

  Fly  1077 ----QVDYIQTDLSADSSLASSFSRSGMDESSLSCR---------------------QPRRLGED 1116
                |:...:..:..|..|:........|:.:|.|:                     |.:.|.:|
  Rat   113 FMPNQLWGFKNFILRDFLLSHRHWLLPEDQLTLCCKVSIVGPFFSRPEHNTIPAIRDQRQVLSDD 177

  Fly  1117 LLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSVVSLQGYSYAAVHFALCH 1181
            |.:::...|.||..:.|.|:..||||.||.:|...|.||......:|:.     :...:|....|
  Rat   178 LGELWENFIFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLESLT-----NRIEIHDIHLH 237

  Fly  1182 --------IYSG-ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHNFHKPCSGCSDGI 1237
                    ||:| |.|.........|.|.||:..|:.||.:...||    |.|.      ..:..
  Rat   238 VFKEMMGFIYTGKAPHLHSHSMATRLLAAADMYDLQDLKVMCEDAL----CRNL------SVENA 292

  Fly  1238 LQVLPVALNHALDDLYRKCLRWTCRHYLKVWPT 1270
            :..|.:|..|:.:.|..|.:.:...|..:|..|
  Rat   293 VSTLILADFHSTEHLKTKAMDFIILHASEVSET 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 21/75 (28%)
BTB 1128..>1191 CDD:197585 21/71 (30%)
BACK 1238..>1281 CDD:197943 8/33 (24%)
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761 27/155 (17%)
BTB_POZ 165..292 CDD:365784 38/141 (27%)
BACK 287..353 CDD:421692 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.