DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and KLHL18

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_005265058.2 Gene:KLHL18 / 23276 HGNCID:29120 Length:584 Species:Homo sapiens


Alignment Length:364 Identity:68/364 - (18%)
Similarity:121/364 - (33%) Gaps:121/364 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1115 EDLLKMFLQEIAT----------------DMLVEVHGRRIRAHKCILRSRCQYFAAMLAG---HG 1160
            |||:...:.|:.:                |:.:::...:..||:.:|.:...||.||...   ..
Human    10 EDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMEC 74

  Fly  1161 SQSVVSLQGYSYAAVHFALCHIYSGASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHN 1225
            .|..:.:||...:|:...:...|:| :...|..::..|...|..|.|:.:|:.....|:    ..
Human    75 KQDEIVMQGMDPSALEALINFAYNG-NLAIDQQNVQSLLMGASFLQLQSIKDACCTFLR----ER 134

  Fly  1226 FH-KPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDILGRCRQQIV 1289
            .| |.|.|... ..:.:..|:      ||.....:..:|:::|..:.:|..||            
Human   135 LHPKNCLGVRQ-FAETMMCAV------LYDAANSFIHQHFVEVSMSEEFLALP------------ 180

  Fly  1290 AYMTSDTVLDTVLDC---DHLLAQLSAYRWGHVCEQLVREILEAAYAYVGDHFASLIASDSFLSL 1351
                    |:.||:.   |.|..:..            .::.|||.|:|                
Human   181 --------LEDVLELVSRDELNVKSE------------EQVFEAALAWV---------------- 209

  Fly  1352 GHDRSRHIPRLETLLLHTAAELTPEQACRSYQRVTRLNTVLQAKVIHMPASLGQSELAR---ELQ 1413
            .:||.:..|.|..||.:....|     ||......|:.               |.:|.|   :.:
Human   210 RYDREQRGPYLPELLSNIRLPL-----CRPQFLSDRVQ---------------QDDLVRCCHKCR 254

  Fly  1414 GLQEEQLDW---------------QPEYIRLVGALVYAV 1437
            .|.:|..|:               :|.....:..|:|||
Human   255 DLVDEAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 15/86 (17%)
BTB 1128..>1191 CDD:197585 14/65 (22%)
BACK 1238..>1281 CDD:197943 8/42 (19%)
KLHL18XP_005265058.2 BTB 28..131 CDD:279045 20/103 (19%)
PHA03098 34..562 CDD:222983 64/340 (19%)
BACK 140..242 CDD:285009 30/161 (19%)
KELCH repeat 282..327 CDD:276965 4/12 (33%)
Kelch 289..341 CDD:128874 4/5 (80%)
Kelch_1 330..375 CDD:279660
KELCH repeat 331..374 CDD:276965
KELCH repeat 378..427 CDD:276965
Kelch 394..440 CDD:128874
KELCH repeat 430..474 CDD:276965
Kelch 441..486 CDD:128874
KELCH repeat 477..521 CDD:276965
Kelch_1 477..520 CDD:279660
Kelch_1 523..567 CDD:279660
KELCH repeat 524..567 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.