DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and bath-44

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_495549.1 Gene:bath-44 / 174210 WormBaseID:WBGene00015567 Length:397 Species:Caenorhabditis elegans


Alignment Length:391 Identity:83/391 - (21%)
Similarity:151/391 - (38%) Gaps:88/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   942 MESLHATIE-KQKQLLETVNEHGEQTTQQPSQIPSSFVKLSDMDKPVKHD---LQSPDSMSKSVG 1002
            |:..||... ...::...|::| ..|.:..||:...:::.|...|.:..|   ||.|        
 Worm     6 MQMRHAADSWSTSEVRSLVHKH-MWTIRGFSQLECRYLETSAKIKDITKDESGLQVP-------- 61

  Fly  1003 NNHRSSQLGQ-----------RLYRDENRARPHSWAMTRSTGNTLQNFTNSVDNIRSLSRLFPNF 1056
            ..|:.|..|.           ||:...|:.....:..       .|.|||     ::.:...|.|
 Worm    62 LTHQPSSSGGLPELPDITFRIRLHPQGNKESNKDFTF-------FQCFTN-----QATTTTTPTF 114

  Fly  1057 SKEFSNSLPNGMTLE----------QVQGQQVDYIQTDL------SADSSL-------------- 1091
            ..:|..::.|..|.|          |:.| ..:||:.::      .||..:              
 Worm   115 RAKFKFTVFNQRTEETPTTVYSGTQQLHG-YFEYIRREVLVGHVQPADDLILCLTITITFDTVTK 178

  Fly  1092 ASSFSRSGMDESSLSCRQPRRLGEDLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAML 1156
            |:..:||...|..:    |..:.:||..::......|..:.|..|.::|||.||.:|...||||:
 Worm   179 AAQNTRSVPPELPM----PSDVTKDLENLYRSGKHADFTLVVEERELKAHKAILAARSPVFAAMM 239

  Fly  1157 AGHGSQSVVS---LQGYSYAAVHFALCHIYSGASHPPDGISLMELAALADLLGLEGLKEVTAHAL 1218
            ..|.:::..|   |:...|..|...|.:||:|......| :.:::.|.|:...|.|||.:...|:
 Worm   240 EPHTAEAQNSRAILRDIDYEVVQAILYYIYTGTCTNMGG-NALDILAAAERFALPGLKNIAEVAM 303

  Fly  1219 KTNYCHNFHKPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLP---PDI 1280
            :...          .::.:.:.|..|..:.|.|..::.:::.|.:...|..:..|.:|.   ||:
 Worm   304 RNGL----------ATETVCKNLAFAEMYGLVDFKKEAIKYICMNANAVINSEGFLRLSRQNPDL 358

  Fly  1281 L 1281
            :
 Worm   359 I 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 22/70 (31%)
BTB 1128..>1191 CDD:197585 22/65 (34%)
BACK 1238..>1281 CDD:197943 10/45 (22%)
bath-44NP_495549.1 MATH 26..174 CDD:238068 32/169 (19%)
BTB 200..303 CDD:279045 30/103 (29%)
BTB 211..307 CDD:197585 30/96 (31%)
SPOP_C 307..369 CDD:269807 10/63 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.