DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and LOC101883073

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_021333335.1 Gene:LOC101883073 / 101883073 -ID:- Length:544 Species:Danio rerio


Alignment Length:396 Identity:87/396 - (21%)
Similarity:138/396 - (34%) Gaps:94/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 GMDESSLSCRQPRRLGEDLLK-MFLQEIATDMLVEV-HGRRIRAHKCILRSRCQYFAAMLAGHGS 1161
            |.|..|.|.|:.|.....|:: ::.:.:..|::::. .|.|:.||..||.:...||.|:..|...
Zfish   189 GGDTVSFSAREERERSLQLIRALWERNVGCDVIIQTDSGDRLPAHCVILAAGADYFRALFCGGLR 253

  Fly  1162 QS---VVSLQGYSYAAVHFALCHIYSGASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYC 1223
            :|   ||.|:|.|...:...|..||||.. .....::.:|...|....|:|..|:..:.|:.|..
Zfish   254 ESRAEVVFLRGVSSWILRDLLEFIYSGRL-KLSSTNVWDLTEAAAQFQLQGALELCLNFLRDNMD 317

  Fly  1224 HNFHKPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDILGRCRQQI 1288
            .|      .|    |.:|.:|..::|:||.::...:...|:.:|....:|..||      |.|  
Zfish   318 EN------SC----LDILALAEAYSLEDLAKRAEDYVLAHFQRVSEGEKFNDLP------CIQ-- 364

  Fly  1289 VAYMTSDTVLDTVLDCDHLLAQLSAYRWGHVCEQLVREILEAAYAYVGDHFASLIASDSFLSLGH 1353
                     |...||.|.|.|....            ::..|...:|.:                
Zfish   365 ---------LKRFLDRDALNADSEI------------DVFRAVVNWVQE---------------- 392

  Fly  1354 DRSRHIPRLETLL------LHTAAELTPEQACRSYQRVTRLNTVLQAKVIHMPASLGQSELAREL 1412
            |:...:..|..|:      |....||...|.|:...|.....|.|              ::.|.|
Zfish   393 DKQHRLSDLSGLMQSVRFPLMRPEELQEVQECKLMLRCAEGKTAL--------------DVVRNL 443

  Fly  1413 QGLQEEQLDWQPEYIRLVGALVYAVEQCLIRQCSR---------AMRVTAWQRMDLELRKKIQTL 1468
            .......:|.:|.....|  ||.....|:.....|         |.|....:.:...:..|  .|
Zfish   444 LCDDRRSMDCKPRTPNQV--LVIVGGDCVNEDFERREPNLCLWFACRFVRGEGLKCSIEWK--PL 504

  Fly  1469 ARLTEP 1474
            |.|.||
Zfish   505 AHLPEP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 21/72 (29%)
BTB 1128..>1191 CDD:197585 22/66 (33%)
BACK 1238..>1281 CDD:197943 11/42 (26%)
LOC101883073XP_021333335.1 BTB 91..188 CDD:321966
BTB 218..>416 CDD:333434 56/253 (22%)
BACK 321..421 CDD:311578 28/148 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.