DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and abtb1

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_003199099.1 Gene:abtb1 / 100536189 ZFINID:ZDB-GENE-141212-241 Length:476 Species:Danio rerio


Alignment Length:448 Identity:87/448 - (19%)
Similarity:156/448 - (34%) Gaps:137/448 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1064 LPNGMTLE--QVQGQQVDYIQTDLSADSSLASSFSRSGMDESSLSCRQPRRLGEDLLKMFLQEIA 1126
            |.||...|  ...|::..|        .:|:.:..|...:...::.:..:|   |....|||.:.
Zfish    56 LANGAKCEANTFDGERCLY--------GALSDAIRRLLKEYKRITAKAMQR---DYYDQFLQTLL 109

  Fly  1127 -----TDMLVEVHGRRIRAHKCILRSRCQYFAAML--AGHGSQSVV------------SLQGYSY 1172
                 :|:...|||...:||:|||.:|.:|||.||  ...|..::.            ::..|.|
Zfish   110 EQGNYSDVTFVVHGEMFKAHRCILSARSEYFAHMLETKWKGKSAIALKHPLVNPAAFGAIMQYFY 174

  Fly  1173 AA-----VHF---------------------ALC-HIYSGASHPP-----------------DGI 1193
            ..     |::                     ..| .:|...|:.|                 ||:
Zfish   175 TGRLDIDVNYVEDCKRLAKQCKIGELIEELEVKCKQVYEFVSNKPGTCVKVLTLDPHDFQLQDGM 239

  Fly  1194 SLMELAAL-ADL----------------------LGLEGLKEVTAHALKTNYC--HNFHKPC--S 1231
            :|:..:|| |:|                      ..:||. :...|  |..:|  .::.|..  .
Zfish   240 ALLADSALPAELRVGYGQLPFDLTDSFPSYPDICFRVEGY-DFLCH--KAFFCGRSDYFKALLED 301

  Fly  1232 GCSDG-ILQVLP----VALNHALDDLYRKCLRW-----TCRHYLKVWPTRQFAQ--LPPDILGRC 1284
            ..|:| .||..|    :.|:....||:.:.|.:     |...:..|:.....|.  |.|.:...|
Zfish   302 HFSEGETLQTHPSIPVITLHDVSHDLFTRILYYIYSDNTQLSHENVYEVLCVADMYLLPGLKRLC 366

  Fly  1285 RQQIVAYMTSDTVLDTVLDCDHLLAQLSAYRWGHV---CEQLVREILEAAYAYVGDHFASLIASD 1346
            .:.:.|.:..:.||       |:......:|...:   |.:.:.:|:|....  ...||.:|..|
Zfish   367 GRTLAALLNEENVL-------HMWRTAKLFRLSRLEDQCTEHMAKIIERLVE--RPEFADMIRED 422

  Fly  1347 SFLSLGHDRSRHIPRLETLLLHTAAELTPEQACRSYQRVTRLNTVLQAKVIHMPASLG 1404
            :........:..||.::.:..|.|:.:      ::|..:...|..|.|..: :.||:|
Zfish   423 AGNVAARQETDSIPLVDEIRFHIASNV------QTYSAIEEANQKLSALEL-LLASIG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 24/113 (21%)
BTB 1128..>1191 CDD:197585 23/120 (19%)
BACK 1238..>1281 CDD:197943 12/53 (23%)
abtb1XP_003199099.1 Ank_2 6..94 CDD:289560 8/45 (18%)
ANK 6..94 CDD:238125 8/45 (18%)
ANK repeat 35..66 CDD:293786 4/9 (44%)
BTB 105..209 CDD:279045 21/103 (20%)
BTB 116..210 CDD:197585 20/93 (22%)
BTB 268..370 CDD:279045 21/104 (20%)
BTB 271..370 CDD:197585 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.