DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and abtb1

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_001096209.1 Gene:abtb1 / 100124760 XenbaseID:XB-GENE-976579 Length:477 Species:Xenopus tropicalis


Alignment Length:436 Identity:95/436 - (21%)
Similarity:163/436 - (37%) Gaps:118/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 CRQPRRLGEDLLKMFLQEIA-TDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGH-GSQSVVSLQG 1169
            |.| |...:|.|:..|::.: :|.:..|||...:||:|:|.:|..|||.|.... ..::|:.|:.
 Frog    95 CMQ-RDYYDDFLQRLLEQGSYSDTVFIVHGESFQAHRCVLSARSPYFAEMFENKWKGKNVIGLKH 158

  Fly  1170 --YSYAAVHFALCHIYSG-----ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHNFH 1227
              .:.||....|.::|:|     ..|..|...|.:...|.||  ::.|:|      |....:.|.
 Frog   159 PLVNPAAFGSILQYLYTGHMDIDVEHVEDCKRLAKQCRLQDL--IDDLEE------KCKKVYEFV 215

  Fly  1228 KPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCR--HYLKVWPTRQFAQLP----------PDI 1280
            ....|....:|.|.|....|..:||   .:...|.  ..|:|    .|.:||          ||:
 Frog   216 SSKPGTCVKVLSVEPSGNGHLQEDL---AILADCALPAELRV----GFGELPFDSTDNFSSYPDV 273

  Fly  1281 LGRCRQQIVAYMTSDTVLDTVLDC---DHLLAQLSAYRWGHVCEQ------------LVREILEA 1330
               | .||..|   :.:......|   |:..|.|.    .|.||.            .:..|.|.
 Frog   274 ---C-FQIAGY---NFLCHKSFFCGRSDYFKALLE----DHFCESHELQALPSIPVITLHNITEE 327

  Fly  1331 A------YAYVGD-------HFASLIASDSFLSLGHDRSRHIPRLETLLLHTAAELTPE------ 1376
            .      |.|..|       .:..|..:|.:|         :|.|:.|...|.|::..|      
 Frog   328 TFMRVLYYIYSDDTELSPDNAYEVLCVADMYL---------LPGLKRLCGKTLAQMLDEDSIIGI 383

  Fly  1377 -QACRSYQRVTRLN---TVLQAKVIHMPASLGQSE-----LARELQGLQEEQLDWQPEYIRLVGA 1432
             :..:.:| :|||.   |...|::|.   .|..||     :..:.:.::|.|   :.:.|.|:..
 Frog   384 WKTAKLFQ-LTRLEDQCTEYMARIIE---KLVDSEEFAAAVREDAEAVEERQ---ETDSIPLIDD 441

  Fly  1433 LVYAVEQCLIRQCSRAMRVTAWQRMDLELRKKIQTLARLTEPLDMK 1478
            :.:.:          ...|..:..:: |..::::.|..|...|:::
 Frog   442 IRFHI----------TSNVQTYSAIE-EANQRLEALENLLASLELE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 21/71 (30%)
BTB 1128..>1191 CDD:197585 21/70 (30%)
BACK 1238..>1281 CDD:197943 14/54 (26%)
abtb1NP_001096209.1 ANK 6..94 CDD:238125
ANK repeat 35..66 CDD:293786
BTB 105..210 CDD:306997 31/112 (28%)
BTB 272..375 CDD:197585 25/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.