DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and AT1G77220

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_565152.1 Gene:AT1G77220 / 844058 AraportID:AT1G77220 Length:484 Species:Arabidopsis thaliana


Alignment Length:346 Identity:106/346 - (30%)
Similarity:176/346 - (50%) Gaps:49/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PLLHVGDGIFLQTKTAQVL-AGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATY 114
            |.|.|..|.:|   |..:| |.|.|..|:.:....|::||..|..|:||::::.::.:||:||..
plant    29 PNLGVDSGQYL---TWPILSASVFVVIAILLPMYLIFEHLASYNQPEEQKFLIGLILMVPVYAVE 90

  Fly   115 SWISLL----FFNSDNVYIYFFTVRDCYEAFVIYNFLSLCYEYLGGEGNIMSEIRGKPI---KTS 172
            |::||:    .||.:       .:|||||||.:|.|.......|.||...:..:..:.:   .|.
plant    91 SFLSLVNSEAAFNCE-------VIRDCYEAFALYCFERYLIACLDGEERTIEFMEQQTVITQSTP 148

  Fly   173 CLYGTC------------CLKGKTYTIG--FLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDG 223
            .|.|||            |.. |.:::|  |....|...:|:.::|.:.|.:.:.|:|||.|.:|
plant   149 LLEGTCSYGVVEHPFPMNCFV-KDWSLGPQFYHAVKIGIVQYMILKMICALLAMILEAFGVYGEG 212

  Fly   224 DWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAI 288
            .::.:.||.|:.::.|.|.:.|||.|..||...:|.|.|.:|:.||.|.||::||::|||:.:|.
plant   213 KFAWNYGYPYLAVVLNFSQTWALYCLVQFYNVIKDKLAPIKPLAKFLTFKSIVFLTWWQGIIVAF 277

  Fly   289 LEKANVISPIVDSAGTVTVEPGTVSAGYQNFFICIEMLFAAIALRYAFPYQVYARS--CISDGHG 351
            |....::.      |::..|   :....|::.|||||..||:...|.||...|.|.  |:     
plant   278 LFSMGLVK------GSLAKE---LKTRIQDYIICIEMGIAAVVHLYVFPAAPYKRGERCV----- 328

  Fly   352 RSVTMQSISSSLKETMNPKDI 372
            |:|.:.|..:|:....:|:::
plant   329 RNVAVMSDYASIDVPPDPEEV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 92/294 (31%)
AT1G77220NP_565152.1 Solute_trans_a 43..320 CDD:397604 92/293 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.