DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and AT1G23070

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_173720.3 Gene:AT1G23070 / 838915 AraportID:AT1G23070 Length:403 Species:Arabidopsis thaliana


Alignment Length:345 Identity:104/345 - (30%)
Similarity:168/345 - (48%) Gaps:56/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLAGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFF 132
            ::.|.....|:.::...|.||||:||||.||:|||.:||:||:|||.|.|||   ::....:...
plant    18 IIGGSFATVAICLSLYSILQHLRFYTNPAEQKWIVSVLFMVPVYATESIISL---SNSKFSLPCD 79

  Fly   133 TVRDCYEAFVIYNFLSLCYEYLGGEGNIMSEIRG---KPI------------KTSCLYGTCCLKG 182
            .:|:|||||.:|:|.|.....||||..::..:..   ||:            |.:..:...|   
plant    80 ILRNCYEAFALYSFGSYLVACLGGERRVVEYLENESKKPLLEEGANESKKKKKKNSFWKFLC--- 141

  Fly   183 KTYTIGFLRFC--KQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLA 245
            ..|.:|...|.  |...:|:.::|...||:...|:..|.|.||::....||.||.::.|.|...|
plant   142 DPYVLGRELFVIEKFGLVQYMILKTFCAFLTFLLELLGVYGDGEFKWYYGYPYIVVVLNFSQMWA 206

  Fly   246 LYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVISPIVDSAGTVTVEPG 310
            |:.|..||..|.:.|...:|:.||.:.|:::|.::|||.|:|:|....::.           :.|
plant   207 LFCLVQFYNVTHERLKEIKPLAKFISFKAIVFATWWQGFGIALLCYYGILP-----------KEG 260

  Fly   311 TVSAGYQNFFICIEMLFAAIALRYAFPYQVY----ARSC-------------ISDG---HGRSVT 355
            ....|.|:|.|||||..||:|..:.||.:.|    ...|             :.:|   ......
plant   261 RFQNGLQDFLICIEMAIAAVAHLFVFPAEPYHYIPVSECGKITAETSKTEVKLEEGGLVETTETQ 325

  Fly   356 MQSISSSLKETMNPKDIMTD 375
            :::..:|:||::  :||:.|
plant   326 VEASGTSIKESV--QDIVID 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 95/287 (33%)
AT1G23070NP_173720.3 Solute_trans_a 17..290 CDD:397604 95/288 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.