DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and AT1G11200

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_563884.1 Gene:AT1G11200 / 837661 AraportID:AT1G11200 Length:295 Species:Arabidopsis thaliana


Alignment Length:275 Identity:93/275 - (33%)
Similarity:142/275 - (51%) Gaps:22/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 CVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFF-TVRD 136
            ||..::..|.|.:.|||.::..|.|||.|:.|:.:.|:||..|::.||.......:..|. .|::
plant    20 CVLLSMHFTMQLVSQHLFYWKKPNEQRAILIIVLMAPVYAINSFVGLLDAKGSKPFFMFLDAVKE 84

  Fly   137 CYEAFVIYNFLSLCYEYLG---GEGNIMSEIRGKPIKTSCLYGTCCLKGKTYTIGF--LRFCKQA 196
            ||||.||..||:|.|.|:.   ....|..|.:|:.|..|  :.......:|..:.:  |:..||.
plant    85 CYEALVIAKFLALMYSYVNISMSARIIPDEFKGREIHHS--FPMTLFVPRTTHLDYLTLKQLKQW 147

  Fly   197 TLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLLT 261
            |.|||:::|:.:.::|.||..|.|  ..|.:   :|: |.|.|:|||||||.|..||......|.
plant   148 TWQFCIIRPVCSILMITLQILGIY--PVWLS---WIF-TAILNVSVSLALYSLVKFYHVFAKELE 206

  Fly   262 PFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVISPIVDSAGTVTVEPGTVSAGYQNFFICIEML 326
            |.:|:.||..:|.::|..||||:.|.||....:|     .:....:|...:....||..:|:||:
plant   207 PHKPLTKFMCVKGIVFFCFWQGIVLKILVGLGLI-----KSHHFWLEVDQLEEALQNVLVCLEMI 266

  Fly   327 FAAIALRYAF---PY 338
            ..:|..:|||   ||
plant   267 VFSIIQQYAFHVAPY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 93/275 (34%)
AT1G11200NP_563884.1 Solute_trans_a 17..280 CDD:281602 91/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.