DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and LAZ1

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_974706.1 Gene:LAZ1 / 829993 AraportID:AT4G38360 Length:485 Species:Arabidopsis thaliana


Alignment Length:324 Identity:99/324 - (30%)
Similarity:162/324 - (50%) Gaps:30/324 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AQVLAGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIY 130
            |..:||..:...|.::...::.||..|.||:||::::.::.:||.|:..|:.||:   ..::.:.
plant    20 ASFMAGAFLVLTLSLSLFLVFDHLSTYKNPEEQKFLIGVILMVPCYSIESFASLV---KPSISVD 81

  Fly   131 FFTVRDCYEAFVIYNFLSLCYEYLGGEGNIMS--EIRG-KPIKTSCLYG-------------TCC 179
            ...:|||||:|.:|.|.......:|||...:.  |.:| |..||..|..             ...
plant    82 CGILRDCYESFAMYCFGRYLVACIGGEERTIEFMERQGRKSFKTPLLDHKDEKGIIKHPFPMNLF 146

  Fly   180 LKGKTYTIGFLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIYNISVSL 244
            ||....:..|.:..|...:|:.::|.|.|...:.|:|||.|.:|::....||.|:.::.|.|.|.
plant   147 LKPWRLSPWFYQVVKFGIVQYMIIKSLTALTALILEAFGVYCEGEFKWGCGYPYLAVVLNFSQSW 211

  Fly   245 ALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVI-SPIVDSAGTVTVE 308
            |||.|..||.||:|.|...:|:.||.|.||::||::||||.:|:|....:. |.|..|.      
plant   212 ALYCLVQFYGATKDELAHIQPLAKFLTFKSIVFLTWWQGVAIALLSSLGLFKSSIAQSL------ 270

  Fly   309 PGTVSAGYQNFFICIEMLFAAIALRYAFPYQVYARSCISDGHGRSVTMQSISSSLKETMNPKDI 372
              .:....|:|.|||||..|::...|.||.:.|  ..:.|....||::....:|:...::|.:|
plant   271 --QLKTSVQDFIICIEMGIASVVHLYVFPAKPY--GLMGDRFTGSVSVLGDYASVDCPIDPDEI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 92/289 (32%)
LAZ1NP_974706.1 Solute_trans_a 22..300 CDD:397604 91/288 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.