DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and AT4G21570

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001329391.1 Gene:AT4G21570 / 828242 AraportID:AT4G21570 Length:324 Species:Arabidopsis thaliana


Alignment Length:301 Identity:93/301 - (30%)
Similarity:147/301 - (48%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWISLL-FFNSDNVYIYFFTVRDC 137
            |...|..|.|.:.|||..:.||:||:.|:.|:.:.||||..|:|.|| ...|:..:::..::::|
plant    21 VLLTLHFTIQLVSQHLFHWKNPKEQKAILIIVLMAPIYAVVSFIGLLEVKGSETFFLFLESIKEC 85

  Fly   138 YEAFVIYNFLSLCYEYL--GGEGNIMSE-IRGKPIKTS---CLYGTCCLKGKTYTIGFLRFCKQA 196
            |||.||..||:|.|.||  ....||:.: |:|:.|..|   .|:....::...:|:..|::.   
plant    86 YEALVIAKFLALMYSYLNISMSKNILPDGIKGREIHHSFPMTLFQPHVVRLDRHTLKLLKYW--- 147

  Fly   197 TLQFCLVKPLVAFIIIFLQAFGHYHDG-DWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLL 260
            |.||.:::|:.:.::|.||..|.|... .|:       .|||.|.|||||||.|.:||......|
plant   148 TWQFVVIRPVCSTLMIALQLIGFYPSWLSWT-------FTIIVNFSVSLALYSLVIFYHVFAKEL 205

  Fly   261 TPFEPVLKFCTIKSVIFLSFWQGVG--------------------LAILEKANVISPIVDSAGTV 305
            .|..|:.||..||.::|..|||.:.                    |.||:...:...|:.:.|.:
plant   206 APHNPLAKFLCIKGIVFFVFWQVMFALISKPLKTRFLMFGYTHKILLILKLQGIALDILVAMGFI 270

  Fly   306 T-----VEPGTVSAGYQNFFICIEMLFAAIALRYAF---PY 338
            .     :|...:....||..:|:||:..|...::|:   ||
plant   271 KSHHFWLEVEQIQEAIQNVLVCLEMVIFAAVQKHAYHAGPY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 93/301 (31%)
AT4G21570NP_001329391.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.