DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and TMEM184C

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_060711.2 Gene:TMEM184C / 55751 HGNCID:25587 Length:438 Species:Homo sapiens


Alignment Length:442 Identity:137/442 - (30%)
Similarity:215/442 - (48%) Gaps:74/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LHVGDGIFLQTKTAQVLAGVCVWAALFITCQQIYQHLRWYTNPQEQRWIVRILFIVPIYATYSWI 117
            |.||    :.|| |..:||:.:...:.|:...|.|||..||.|:.|:.|:|||::||||:..|||
Human    40 LEVG----IHTK-AWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWI 99

  Fly   118 SLLFFNSDNVYIYFFTVRDCYEAFVIYNFLSLCYEYLGGE-GNIMSEIRGK-------PIKTSCL 174
            :|.:   ..:.||..|.|:||||:|||||:.....||... .|::..:..|       |:   | 
Human   100 ALKY---PGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPL---C- 157

  Fly   175 YGTCCLKGKTYTIG--FLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITII 237
               ||   ..:.:|  .|..||...||:.:|:|....:.:..:..|.|.:|::|....:.|:.||
Human   158 ---CC---PPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVII 216

  Fly   238 YNISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVISPIVDSA 302
            .|:|...|:|.|.|||...::.|:|.:||.||..:|.|:|:||||.|.:|:|.|..|||. ..:.
Human   217 NNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISE-KHTW 280

  Fly   303 GTVTVEPGTVSAGYQNFFICIEMLFAAIALRYAFPYQVYAR-----SCISDGHGRSVTMQSISSS 362
            ...|||  .|:.|.|:|.|||||..||||..|.|.|:.|.:     ||...    .:.|..:|  
Human   281 EWQTVE--AVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEGSCFDS----FLAMWDVS-- 337

  Fly   363 LKETMNPKDIMTDAIHNF------HPQYQQYTQYSSGGKNSRGIRVSSYDPDDPSSGAAAGGMQA 421
                 :.:|.:::.:.:.      ||:.:.:.:.....:::..:..||.|         |..:.:
Human   338 -----DIRDDISEQVRHVGRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQD---------AISIAS 388

  Fly   422 SQPTS--GGYDAVA------TGPGSGGNGGSNCMASKTLGNQRKFQPGGQRV 465
            |.|.|  |.|....      |.|.:...  |:.:.|.|:|.::  :|..:.|
Human   389 SMPPSPMGHYQGFGHTVTPQTTPTTAKI--SDEILSDTIGEKK--EPSDKSV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 106/282 (38%)
TMEM184CNP_060711.2 Solute_trans_a 50..316 CDD:308940 106/281 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..438 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1529
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.