DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and CG6836

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster


Alignment Length:282 Identity:52/282 - (18%)
Similarity:90/282 - (31%) Gaps:102/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IVRILFIVPIYATYSWISLLFFNSDNVYIYFFTVRDCYEAFVIYNFLSLCYEYLGGEGNIMSEIR 165
            |:.:..:|.|...|||     |....|....|.|....       |.:|.:.|:|.|.|.:.|..
  Fly    93 IISVAALVTILVPYSW-----FICHTVMHVMFMVGGPV-------FRTLLFRYVGSEQNYVKETA 145

  Fly   166 GKPIKTSCLYGTCCLKGKTYTIGFLRFCKQATLQFCLVKPLV---------AFIIIFLQAFGHYH 221
            |:.::.:.....||                     ||..|:|         :..:::...|    
  Fly   146 GEAVQLNTPPCCCC---------------------CLCLPMVIPTKAKLCISRYMVWQMPF---- 185

  Fly   222 DGDWSADGGYIYITIIYNISV--SLALYGLYLFYF----------------ATRDLLTP------ 262
               |...     |.::.||..  .:.||...:|:|                .|..::|.      
  Fly   186 ---WQGS-----IMLVMNILYYRDIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQ 242

  Fly   263 -------FEPVLKFCTIKSVIFLSFWQGVGLAILEKANVISPIVDSAGTVTVEPGTVSAGYQNFF 320
                   .:.|:..|.::.::......|:      |.....||     ..||...|:.    |..
  Fly   243 LRKKMFCLQLVVMLCKLQYLVLYDQLDGI------KMGGEYPI-----NHTVYKQTII----NIL 292

  Fly   321 ICIEMLFAAIALRYAF--PYQV 340
            |.:||:..::.::.|:  |.||
  Fly   293 ILVEMVLVSMMVQSAYRTPVQV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 50/279 (18%)
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 49/275 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.