DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and Slc51a

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001100557.1 Gene:Slc51a / 303879 RGDID:1311100 Length:340 Species:Rattus norvegicus


Alignment Length:259 Identity:49/259 - (18%)
Similarity:94/259 - (36%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YTNPQEQRWIVRILFIVPIYATYSWISLLFFN--------SDNVYIY------------------ 130
            :::|.....::|.|..|.|..|   |.|.||.        .|.:|:|                  
  Rat    33 FSHPPTAAQLLRELGSVEIALT---IILTFFTIGSVAIFLEDAIYLYKNTLCPIKKRTLIWSSSA 94

  Fly   131 --FFTVRDCYEAFV----------IYNFLSLCY--------EYLGGEGNIMSEIRGKPIKT---- 171
              ..:|..|:..::          |.:|.::|:        |..||:..::..::..|::.    
  Rat    95 PTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFYLLMMVMVEGFGGKEAVLRTLKDTPMRVHTGP 159

  Fly   172 SCLYGTCC----LKGKTYTIGFLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYI 232
            .|....||    |..|.     |:.......|:...|.:::.:.:||...|.|...:.|.....:
  Rat   160 CCCCCPCCPPLILTRKK-----LQLLMLGPFQYAFFKIVMSIVGLFLIPDGIYDPAEISEKSAAL 219

  Fly   233 YITIIYNISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVIS 296
            :|:....:|..|||:.|.:.:...:..|.......||...:.::.|:..|....:||..:..|:
  Rat   220 WISNFLAVSTLLALWSLAILFRQAKLHLGEQNMGSKFALFQVLVILTALQPSIFSILANSGQIA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 49/259 (19%)
Slc51aNP_001100557.1 Solute_trans_a 53..321 CDD:397604 44/239 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.