DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and Tmem184c

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001351374.1 Gene:Tmem184c / 234463 MGIID:2384562 Length:662 Species:Mus musculus


Alignment Length:442 Identity:132/442 - (29%)
Similarity:196/442 - (44%) Gaps:90/442 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PLLHVGDGIFLQTKTAQVLAGVCVW----------------AALF------ITCQQIYQHLRWYT 93
            |||     :.....|..|...:|:|                |.:|      ::...|.|||..||
Mouse    56 PLL-----VLFYATTILVAVPICIWKFQKMKVGMHTKSWFIAGIFLLLTIPVSLWGILQHLVHYT 115

  Fly    94 NPQEQRWIVRILFIVPIYATYSWISLLFFNSDNVYIYFFTVRDCYEAFVIYNFLSLCYEYLGGE- 157
            .|:.|:.|:|||::||||:..||::|::   ..:.||..|.|:||||:|||||:.....||... 
Mouse   116 QPELQKPIIRILWMVPIYSVDSWVALVY---PKIAIYVDTWRECYEAYVIYNFMIFLTNYLTIRF 177

  Fly   158 GNIMSEIRGKPIKTSCLYGTCCLKGKTYTIG-FLRF-CKQATLQFCLVKPLVAFIIIFLQAFGHY 220
            .|::..:..|..:...|...||   ..:.:| .|.| ||...||:.:|:|:.....:..:....|
Mouse   178 PNLILHLEAKDQQNHILPLCCC---PPWAMGEMLLFRCKLGVLQYTVVRPITTVTALVCEILDVY 239

  Fly   221 HDGDWSADGGYIYITIIYNISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVG 285
            .:|::.....:.|:.|:.|:|...|:|.|.|||...::.|:|.:||.||..:|.|:|:||||.|.
Mouse   240 DEGNFGFSNAWTYLVILNNLSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVL 304

  Fly   286 LAILEKANVISPIVDSAGTVTVEPGT--------VSAGYQNFFICIEMLFAAIALRYAFPYQVYA 342
            :|:|.|..|||           |..|        |:.|.|:|.|||||.|||||..|.|.|:.|.
Mouse   305 IALLVKLGVIS-----------EKRTWEWQSAEAVATGLQDFIICIEMFFAAIAHHYTFSYKPYV 358

  Fly   343 R-----SCISDGHGRSVTMQSISSSLKETMNPKDIMTDAIHNFHPQYQQYTQYSSGGKNSRGIRV 402
            .     ||...    .:.|..:|          ||..|...          |....|:..||...
Mouse   359 HEAEEGSCFDS----FLAMWDVS----------DIRDDISE----------QVRRVGRTMRGYPK 399

  Fly   403 SSYDPDDPSSGAAAGGM-QASQPTSGGYDAVATGPGSGG--NGGSNCMASKT 451
            ....|.||.....:..: .:||..:.|...|   |..||  .|..:.::|::
Mouse   400 KKCFPGDPDHNEHSSLLSSSSQDLTSGSSKV---PSPGGLYQGFGHTISSQS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 103/305 (34%)
Tmem184cNP_001351374.1 Solute_trans_a 90..356 CDD:308940 101/282 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.