DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12004 and SLC51A

DIOPT Version :9

Sequence 1:NP_001097474.1 Gene:CG12004 / 38185 FlyBaseID:FBgn0035236 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_689885.4 Gene:SLC51A / 200931 HGNCID:29955 Length:340 Species:Homo sapiens


Alignment Length:253 Identity:50/253 - (19%)
Similarity:90/253 - (35%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YTNPQEQRWIVRILFIVPIYATYSWISLL------FFNSDNVYIY-------------------- 130
            ::.|.....::|.|..|.:..| |.::||      .|..|.||:|                    
Human    33 FSQPPTAAQLLRALGPVELALT-SILTLLALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPT 96

  Fly   131 FFTVRDCYEAFV----------IYNFLSLCY--------EYLGGEGNIMSEIRGKPIKT----SC 173
            ..:|..|:..::          |.:|.::|:        |..||:..::..:|..|:..    .|
Human    97 VVSVLCCFGLWIPRSLVLVEMTITSFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCC 161

  Fly   174 LYGTCCLKGKTYTIGFLRFCKQATLQFCLVKPLVAFIIIFLQAFGHYHDGDWSADGGYIYITIIY 238
            ....||.: ...|...|:.......|:..:|..:..:.:||...|.|...|.|.....::|....
Human   162 CCCPCCPR-LLLTRKKLQLLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFL 225

  Fly   239 NISVSLALYGLYLFYFATRDLLTPFEPVLKFCTIKSVIFLSFWQGVGLAILEKANVIS 296
            .:|..|||:.|.:.....|..|.......||...:.::.|:..|....::|.....|:
Human   226 GVSTLLALWTLGIISRQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12004NP_001097474.1 Solute_trans_a 66..339 CDD:397604 50/253 (20%)
SLC51ANP_689885.4 Solute_trans_a 53..321 CDD:281602 46/233 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.