DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7879 and AT5G66010

DIOPT Version :9

Sequence 1:NP_647626.1 Gene:CG7879 / 38184 FlyBaseID:FBgn0035235 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_201402.3 Gene:AT5G66010 / 836731 AraportID:AT5G66010 Length:255 Species:Arabidopsis thaliana


Alignment Length:89 Identity:28/89 - (31%)
Similarity:50/89 - (56%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIRLQNLPWTANARDIRNFFSGLSIPEGGVHII----GGEMGDAFIAFSTDEDARCAMLKDREKL 64
            :::::.||::.|...|..||||..:.:|.|.::    |...|:||:.|.|.|:||.||.||:..:
plant   167 VLKMRGLPYSVNKPQIIEFFSGYKVIQGRVQVVCRPDGKATGEAFVEFETGEEARRAMAKDKMSI 231

  Fly    65 MEIQVRLLLSSRAEMQKVIETARK 88
            ....|.|..::|.|.::....:|:
plant   232 GSRYVELFPTTREEARRAEARSRQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7879NP_647626.1 RRM1_RBM12_like 2..75 CDD:240954 25/74 (34%)
RRM_hnRNPH_ESRPs_RBM12_like 355..425 CDD:240700
RRM <364..551 CDD:223796
RRM_SF 478..549 CDD:240668
RRM_SF 702..773 CDD:240668
RRM_hnRNPH_ESRPs_RBM12_like 910..982 CDD:240700
AT5G66010NP_201402.3 RRM_hnRNPH_ESRPs_RBM12_like 50..119 CDD:409699
RRM_hnRNPH_ESRPs_RBM12_like 167..239 CDD:409699 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13976
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.