DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7879 and AT3G20890

DIOPT Version :9

Sequence 1:NP_647626.1 Gene:CG7879 / 38184 FlyBaseID:FBgn0035235 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_188725.3 Gene:AT3G20890 / 821638 AraportID:AT3G20890 Length:292 Species:Arabidopsis thaliana


Alignment Length:333 Identity:71/333 - (21%)
Similarity:109/333 - (32%) Gaps:99/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 YNGNSNG-----NGPNYPN--DNGGAGVIQRPRQEDVF------------------VRVHNCEYA 710
            |.|..:|     .||....  |.|..|....|.....|                  ||:....:.
plant     3 YRGYGDGPDGREMGPKRQRMIDQGPPGPFYGPHPSSGFMYNPYGFVAPPPPPPFPAVRLRGLPFD 67

  Fly   711 TRANDLGELFSLEHLRIEHIEQLFNERNQS-SGEFIVEFSDPASCKLAIREFHNRRFRGRG-LRV 773
            ....|:.|.|.    .::.::.||..||.. :||.......|.....|:::  ||:..||. :.|
plant    68 CAELDVVEFFH----GLDVVDVLFVHRNNKVTGEAFCVLGYPLQVDFALQK--NRQNMGRRYVEV 126

  Fly   774 VAITPQE----IADRMKKPFMDYLPGGNGPRKAETNNANDGAGGNKASAQPSRRRGPSRFDKPQE 834
            ...|.||    ||:.:.:..:..:..|.|......|.:..|.||.....:.|....|.|      
plant   127 FRSTKQEYYKAIANEVAESRVHGMASGGGGGLGGGNGSGGGGGGGGGGGRISGGSSPRR------ 185

  Fly   835 QPSQQQDRPLSLEREDNSSTSSNAPVKQHFNPFARPDPPLSSSSLSPSNQGQVKPTSPVPVPTSI 899
              ..|:.|.....:||...|.                                            
plant   186 --HVQRARSSDDGKEDIEHTG-------------------------------------------- 204

  Fly   900 IPDKFNRPGCVVAMRNVPFKAELKDIMRFFSDYKLSPDDIIRRFNDEGKPTGDTRVAFESPSEAR 964
                      ::.:|.:||.|..:||:.||.|::||.|.:....|.||:|||:..|.|.:..::|
plant   205 ----------ILRLRGLPFSAGKEDILDFFKDFELSEDFVHVTVNGEGRPTGEAFVEFRNAEDSR 259

  Fly   965 SAFESRRK 972
            :|....||
plant   260 AAMVKDRK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7879NP_647626.1 RRM1_RBM12_like 2..75 CDD:240954
RRM_hnRNPH_ESRPs_RBM12_like 355..425 CDD:240700
RRM <364..551 CDD:223796
RRM_SF 478..549 CDD:240668
RRM_SF 702..773 CDD:240668 17/72 (24%)
RRM_hnRNPH_ESRPs_RBM12_like 910..982 CDD:240700 24/63 (38%)
AT3G20890NP_188725.3 RRM_hnRNPH_ESRPs_RBM12_like 60..127 CDD:409699 16/72 (22%)
RRM_hnRNPH_ESRPs_RBM12_like 205..277 CDD:409699 24/63 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001433
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13976
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.