DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7879 and hnrnph1

DIOPT Version :9

Sequence 1:NP_647626.1 Gene:CG7879 / 38184 FlyBaseID:FBgn0035235 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_991247.1 Gene:hnrnph1 / 402984 ZFINID:ZDB-GENE-040426-1856 Length:403 Species:Danio rerio


Alignment Length:431 Identity:93/431 - (21%)
Similarity:157/431 - (36%) Gaps:118/431 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIRLQNLPWTANARDIRNFFSGLSIPEGG--VHII----GGEMGDAFIAFSTDEDARCAMLKDRE 62
            ::|::.|||:.:..:::.|||...|...|  :|..    |...|:||:.|.::||.:.|:.||||
Zfish     8 VVRVRGLPWSCSVDEVQRFFSECKIASNGTSIHFTYTREGRPSGEAFVEFESEEDLKIAVKKDRE 72

  Fly    63 KLMEIQVRLLLSSRAEMQKVIETARKAASAQAPVSVPVPMPVVVPVTAAKVAGPAAPLPPIIGGL 127
            .:....|.:..|:..||..|:                            |..||..   |..||.
Zfish    73 TMGHRYVEVFKSNSVEMDWVL----------------------------KHTGPNC---PETGGD 106

  Fly   128 NTFLGQGQVKGVATGTVPSFLTYQQ--QAGITLS-DVTGRRSRS---RSSSSDDSDRERERDRQR 186
            .....:|...|.:...:..|....:  ..||||. |..||.:..   :.:|.|.:::..::.::|
Zfish   107 GLVRLRGLPFGCSKEEIVQFFAGLEIVPNGITLPVDFQGRSTGEAFVQFASQDIAEKALKKHKER 171

  Fly   187 ERERGRK-RRSDRLDKSQERELKMVAGGGALPSPWAQPPQNQLPAVGLGLN-MGLNLNLPQI--- 246
            ...|..: .:|.|.:.....|.:....|...|||:.:      |..|.|.| ||..::..::   
Zfish   172 IGHRYIEIFKSSRAEVRTHYEPQRKVMGMQRPSPYDR------PGGGRGYNSMGRGVSFERMRRG 230

  Fly   247 ------------PSLQSYT----------TSTTTTNVTNNYN-LEPSATSVQL-----LTALQQV 283
                        .|.||.|          ...|.|::.|.:: |.|....:::     :|....|
Zfish   231 GYGGDGRYGDSGSSFQSTTGHCVHMRGLPYRATETDIYNFFSPLNPVRVHLEIGPDGRVTGEADV 295

  Fly   284 SSGSAAPAQPSKSESEPIAFASVNPYAQM---YPQLFQQQ-----------QML--LQQQQTQAK 332
            ...:...|..:.|:.:          |.|   |.:||...           ||:  :..|.:...
Zfish   296 EFATHEDAVAAMSKDK----------ANMQHRYVELFLNSTAGGGSGGYGGQMMGGMGNQSSYGH 350

  Fly   333 VSPTMGGSPGGGSTPQVVADTCYIRMSGMCQNTSYSDIRKY 373
            .|..||...|||          |...|||...:.||:.:.:
Zfish   351 SSQQMGSGYGGG----------YANQSGMGGYSDYSECQLF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7879NP_647626.1 RRM1_RBM12_like 2..75 CDD:240954 23/76 (30%)
RRM_hnRNPH_ESRPs_RBM12_like 355..425 CDD:240700 6/19 (32%)
RRM <364..551 CDD:223796 2/10 (20%)
RRM_SF 478..549 CDD:240668
RRM_SF 702..773 CDD:240668
RRM_hnRNPH_ESRPs_RBM12_like 910..982 CDD:240700
hnrnph1NP_991247.1 RRM <5..>74 CDD:223796 22/65 (34%)
RRM1_hnRNPH_hnRNPH2_hnRNPF 6..84 CDD:241173 23/75 (31%)
RRM <57..>168 CDD:223796 31/141 (22%)
RRM_SF 89..184 CDD:302621 23/125 (18%)
RRM3_hnRNPH_hnRNPH2_hnRNPF 251..326 CDD:241178 14/84 (17%)
RRM <251..>307 CDD:223796 8/55 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.