DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and RNF40

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001273501.1 Gene:RNF40 / 9810 HGNCID:16867 Length:1001 Species:Homo sapiens


Alignment Length:276 Identity:58/276 - (21%)
Similarity:100/276 - (36%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHGFASANNLQTLGEEYTGI-IQVD 81
            :::.|...:|.|......:|...|  ||.||:.:||.|          ....|||:..|: .|||
Human   770 EQNGRLLQQLREKDDANFKLMSER--IKANQIHKLLRE----------EKDELGEQVLGLKSQVD 822

  Fly    82 GNYKQIPSRLLQLIAIVLEFGGD----SLFQRLMQKLDTYVANNDEIRTEIKPQLKKIIQRLRQ- 141
            .....:.....:..|:....||.    :|..:.::..........::..::|.||:.:..|||: 
Human   823 AQLLTVQKLEEKERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREI 887

  Fly   142 SPSYVK---ALHKSLFYLDASKYQLSKRTTGINYVLIRHWLQPEFSLYGYKILGVITFLQVSVSL 203
            .|...:   |..|..|.|..::..:|:         :|..|:.:..:..|.....|  ||..:  
Human   888 QPCLAESRAAREKESFNLKRAQEDISR---------LRRKLEKQRKVEVYADADEI--LQEEI-- 939

  Fly   204 AISGWDAWREHKRQQLESIKQAGKNFLQRSSSTKDVDPNTPQCILCLEPRSDSSLTPCGHIFCWS 268
                    :|:|.:.                          .|..|...:.|:.||.|.|:||:.
Human   940 --------KEYKARL--------------------------TCPCCNTRKKDAVLTKCFHVFCFE 970

  Fly   269 CLLEWLEERD-ECPLC 283
            |:....|.|. :||.|
Human   971 CVRGRYEARQRKCPKC 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595 35/161 (22%)
zf-RING_2 244..284 CDD:290367 15/41 (37%)
RNF40NP_001273501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146
SMC_N 231..920 CDD:330553 36/170 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 518..652
RING-HC_RNF40 945..999 CDD:319729 15/68 (22%)
RING-HC finger (C3HC4-type) 948..986 CDD:319729 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.