DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and AT1G74990

DIOPT Version :10

Sequence 1:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_177636.1 Gene:AT1G74990 / 843837 AraportID:AT1G74990 Length:137 Species:Arabidopsis thaliana


Alignment Length:65 Identity:22/65 - (33%)
Similarity:38/65 - (58%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SSTKDVDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWL---EERDECPLCRESLKKSQVILL 295
            ::.:|...|...|.:|||...:..:|.|||:|||.||.:||   .:.:.||:|:..:|:..::.|
plant     7 TNEEDDASNNFGCNICLELAREPIVTLCGHLFCWPCLYKWLHYHSKSNHCPVCKALVKEDTLVPL 71

  Fly   296  295
            plant    72  71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 20/55 (36%)
RING-HC_PEX10 244..295 CDD:438190 19/53 (36%)
AT1G74990NP_177636.1 PLN03208 6..>97 CDD:178747 22/65 (34%)
RING-HC_AtRMA-like 17..61 CDD:438403 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.