DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and AT3G07200

DIOPT Version :10

Sequence 1:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_187376.1 Gene:AT3G07200 / 819908 AraportID:AT3G07200 Length:182 Species:Arabidopsis thaliana


Alignment Length:95 Identity:27/95 - (28%)
Similarity:41/95 - (43%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 QLESIKQAGKNFLQR----SSSTKDVDPNTPQ---------------CILCLEPRSDSSLTPCGH 263
            |:..::.||.|...|    .:|...|:.|.|:               |.:||.|.:....|.|||
plant    80 QVVDVESAGANRSTRRRSDQTSVDSVELNKPRKSKAVAPPVEEPKFSCPICLCPFTQEVSTKCGH 144

  Fly   264 IFCWSCLLEWLEERDECPLCRESLKKSQVI 293
            |||..|:...|..:.:||.||:.:....:|
plant   145 IFCKKCIKNALSLQAKCPTCRKKITVKDLI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 26/87 (30%)
RING-HC_PEX10 244..295 CDD:438190 19/65 (29%)
AT3G07200NP_187376.1 RING_Ubox 126..177 CDD:473075 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.