DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and AT2G42030

DIOPT Version :10

Sequence 1:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_181733.1 Gene:AT2G42030 / 818803 AraportID:AT2G42030 Length:425 Species:Arabidopsis thaliana


Alignment Length:74 Identity:26/74 - (35%)
Similarity:37/74 - (50%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 EHKRQQLESIKQAGKNFLQRSSSTKDVDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE-- 275
            |.||...:|:...|..|               .|.:||:...|..:|.|||::|||||.:||:  
plant   123 EEKRDVEKSVGSDGSFF---------------DCYICLDLSKDPVVTNCGHLYCWSCLYQWLQVS 172

  Fly   276 ERDECPLCR 284
            |..|||:|:
plant   173 EAKECPVCK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 26/74 (35%)
RING-HC_PEX10 244..295 CDD:438190 20/43 (47%)
AT2G42030NP_181733.1 PLN03208 124..>214 CDD:178747 25/73 (34%)
RING-HC_RNF5-like 139..181 CDD:438196 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.