DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and RNF5

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_008844.1 Gene:RNF5 / 6048 HGNCID:10068 Length:180 Species:Homo sapiens


Alignment Length:56 Identity:23/56 - (41%)
Similarity:38/56 - (67%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 TPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVILL 295
            |.:|.:|||...::.::.|||::||.||.:|||   ||.|||:|:..:.:.:|:.|
Human    24 TFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595
zf-RING_2 244..284 CDD:290367 19/42 (45%)
RNF5NP_008844.1 PLN03208 21..>116 CDD:178747 23/56 (41%)
RING-HC_RNF5 25..70 CDD:319657 20/44 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.