powered by:
Protein Alignment Pex10 and RNF5
DIOPT Version :9
Sequence 1: | NP_001261265.1 |
Gene: | Pex10 / 38182 |
FlyBaseID: | FBgn0035233 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_008844.1 |
Gene: | RNF5 / 6048 |
HGNCID: | 10068 |
Length: | 180 |
Species: | Homo sapiens |
Alignment Length: | 56 |
Identity: | 23/56 - (41%) |
Similarity: | 38/56 - (67%) |
Gaps: | 3/56 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 TPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVILL 295
|.:|.:|||...::.::.|||::||.||.:||| ||.|||:|:..:.:.:|:.|
Human 24 TFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPL 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.