DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and PEX12

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_000277.1 Gene:PEX12 / 5193 HGNCID:8854 Length:359 Species:Homo sapiens


Alignment Length:340 Identity:70/340 - (20%)
Similarity:122/340 - (35%) Gaps:82/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QPEIVRSVQKDARYTNELAEDLSDVLRLTGPRN-------WIKYNQMCRLLAELSYHGFASANNL 67
            ||.|...|.:|:..| .:...|..|:::....|       |..::::..||..|....:.|..: 
Human    17 QPSIFEVVAQDSLMT-AVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTS- 79

  Fly    68 QTLGEEYTG---IIQVDGNYKQ------IPSRLL--QLIAIVLEFGGDSLFQRLMQKLDTYVAN- 120
            .:..|.:.|   |:..|.:..|      :|.:.|  .::.:|       |...|..||:..|:: 
Human    80 ASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLV-------LLPYLKVKLEKLVSSL 137

  Fly   121 NDEIRTEIKP---QLKKIIQRLRQSPSYVKALHKSLFYLDASKYQLSK--------RTTGI---- 170
            .:|....|.|   :.|:..:....:..:|....:..|.:...:|.|.|        |..|:    
Human   138 REEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGR 202

  Fly   171 ----NYVLIRH-------WLQPEFSL-----------YGYKILGVITFLQVSV-SLAISGWDAWR 212
                :...:.|       ..||..|:           .|...|.:.|.|.|.| .|....|  |.
Human   203 LTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDW--WY 265

  Fly   213 EHKRQQLESIKQAGKNFLQRSSSTKDVDPNTPQ---------CILCLEPR-SDSSLTPCGHIFCW 267
            ..:.|  |:||..  ..|........:|.|:..         |.||.:.| :|:.|...|::||:
Human   266 SSENQ--ETIKSL--TALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCY 326

  Fly   268 SCLLEWLEERDECPL 282
            .|:..::.....||:
Human   327 RCVFHYVRSHQACPI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595 34/190 (18%)
zf-RING_2 244..284 CDD:290367 12/49 (24%)
PEX12NP_000277.1 Pex2_Pex12 26..267 CDD:282595 47/251 (19%)
RING 304..341 CDD:214546 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.