DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and PEX10

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:348 Identity:105/348 - (30%)
Similarity:160/348 - (45%) Gaps:61/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARARQPEIVRSVQKDARYTNELAEDLSDVLR-LTGPRNWIKYNQMCRLLAELSYHGFASANNLQT 69
            |.|..||::|:.|||..|...|.......|. |.|.|.|:::.:...||::::|.|..:....||
Human     4 AAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQT 68

  Fly    70 LGEEYTGIIQVDGNYKQIPSRL----LQLIAIVLEFGGDSLFQRLMQKLDTYVANNDEIRTEIKP 130
            |||||..|||||.:...:||.|    |..:..||.:..|.....|.|:|.....:...::..:.|
Human    69 LGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGP 133

  Fly   131 ---------------------QLKKIIQR----LRQSPSYVKALHKSLFYLDASKYQLSKRTTGI 170
                                 |.::.:.|    |||..:.::.||.:.||:....|.|:||.|||
Human   134 GGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGI 198

  Fly   171 NYVLIRHWLQPE-----------------FSLYG--------YKILGVITFLQVSVSLAISGWDA 210
            .|..:|    |:                 .||.|        |::||||:.|.:.:|:.:..: .
Human   199 TYQALR----PDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLY-G 258

  Fly   211 WREHKRQQLESIKQAGKNFLQRSSSTKDVDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE 275
            :|:.:|.:.|.....|.:..:.|...:.|..| |.|.||||.|...:.|||||:|||.|:..|..
Human   259 FRQRQRARKEWRLHRGLSHRRASLEERAVSRN-PLCTLCLEERRHPTATPCGHLFCWECITAWCS 322

  Fly   276 ERDECPLCRESLKKSQVILLQNY 298
            .:.|||||||.....::|.|::|
Human   323 SKAECPLCREKFPPQKLIYLRHY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595 51/182 (28%)
zf-RING_2 244..284 CDD:290367 21/39 (54%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:282595 65/249 (26%)
RING 293..334 CDD:238093 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149659
Domainoid 1 1.000 75 1.000 Domainoid score I9105
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5671
Inparanoid 1 1.050 156 1.000 Inparanoid score I4307
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54217
OrthoDB 1 1.010 - - D1593722at2759
OrthoFinder 1 1.000 - - FOG0005524
OrthoInspector 1 1.000 - - oto89260
orthoMCL 1 0.900 - - OOG6_103665
Panther 1 1.100 - - LDO PTHR23350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X4476
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.