DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and CG8141

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster


Alignment Length:51 Identity:18/51 - (35%)
Similarity:25/51 - (49%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE--ERDECPLCRESL 287
            :||..  |..|.:......:|.|||:|||:||...|.  .:..||.|:..|
  Fly    80 LDPYV--CNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPRCPCCQRHL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595
zf-RING_2 244..284 CDD:290367 14/41 (34%)
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.