powered by:
Protein Alignment Pex10 and Rnf4
DIOPT Version :9
Sequence 1: | NP_001261265.1 |
Gene: | Pex10 / 38182 |
FlyBaseID: | FBgn0035233 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001291198.1 |
Gene: | Rnf4 / 19822 |
MGIID: | 1201691 |
Length: | 194 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 32/66 - (48%) |
Gaps: | 13/66 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 235 STKDVDPNTPQ------CILCLEPRSD-------SSLTPCGHIFCWSCLLEWLEERDECPLCRES 286
||||.....|: |.:|::..|: ...|.|||:||..||.:.|:..:.||.||:.
Mouse 119 STKDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKK 183
Fly 287 L 287
:
Mouse 184 I 184
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.