DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and Rnf185

DIOPT Version :10

Sequence 1:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_663330.2 Gene:Rnf185 / 193670 MGIID:1922078 Length:228 Species:Mus musculus


Alignment Length:57 Identity:23/57 - (40%)
Similarity:37/57 - (64%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 NTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVILL 295
            :|.:|.:||:...|:.::.|||:|||.||.:|||   .|..||:|:..:.:.:||.|
Mouse    71 STFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 20/47 (43%)
RING-HC_PEX10 244..295 CDD:438190 21/53 (40%)
Rnf185NP_663330.2 dermokine <39..>76 CDD:455732 1/4 (25%)
RING-HC_RNF185 73..129 CDD:438402 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.