DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and C32D5.11

DIOPT Version :10

Sequence 1:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001364718.1 Gene:C32D5.11 / 174052 WormBaseID:WBGene00016318 Length:728 Species:Caenorhabditis elegans


Alignment Length:62 Identity:23/62 - (37%)
Similarity:34/62 - (54%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SSSTKDVDP-NTPQCILCLEPR--SDSSLTPCGHIFCWSCLLEWLEE--RDECPLCRESLKK 289
            |.||...:| ...||.:||..|  .:..:..|.|.||:||:.||:.:  |..||:||:.:.|
 Worm    12 SPSTSSNNPVEELQCTICLSTRFSQECRIEGCNHSFCFSCISEWVCQSLRPSCPMCRKDVDK 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 22/58 (38%)
RING-HC_PEX10 244..295 CDD:438190 19/50 (38%)
C32D5.11NP_001364718.1 RAD18 24..>114 CDD:227719 19/50 (38%)
RING_Ubox 26..68 CDD:473075 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.