DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and rnf5

DIOPT Version :9

Sequence 1:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_003200552.1 Gene:rnf5 / 100537822 ZFINID:ZDB-GENE-100805-3 Length:205 Species:Danio rerio


Alignment Length:62 Identity:24/62 - (38%)
Similarity:40/62 - (64%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KDVDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVILL 295
            :|.:..|.:|.:||:...|:.::.|||:|||.||.:|||   .|.:||:|:..:.:.:||.|
Zfish    38 RDRERATFECNICLDTARDAVISLCGHLFCWPCLHQWLETRPSRQQCPVCKAGISRDKVIPL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595
zf-RING_2 244..284 CDD:290367 18/42 (43%)
rnf5XP_003200552.1 PLN03208 45..>141 CDD:178747 22/55 (40%)
RING 46..91 CDD:238093 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.