DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12099 and SLX8

DIOPT Version :9

Sequence 1:NP_647623.1 Gene:CG12099 / 38181 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_011041.3 Gene:SLX8 / 856852 SGDID:S000000918 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:75 Identity:27/75 - (36%)
Similarity:42/75 - (56%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 EELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLSDKTWRK---CPICYDAIHAGDLKSCTIEQ 269
            ::.:||||..||..|.:|.|||.:|.|||...:: |.:|.|:   |.:|...::   ||...:..
Yeast   202 KDYRCPICFEPPETALMTLCGHVFCCPCLFQMVN-SSRTCRQFGHCALCRSKVY---LKDVRLII 262

  Fly   270 LRDLQVGEKI 279
            ||..||.:|:
Yeast   263 LRKKQVKKKV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 19/43 (44%)
SLX8NP_011041.3 PEX10 1..264 CDD:227861 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1987
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.