powered by:
Protein Alignment CG12099 and SLX8
DIOPT Version :9
Sequence 1: | NP_647623.1 |
Gene: | CG12099 / 38181 |
FlyBaseID: | FBgn0035232 |
Length: | 708 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011041.3 |
Gene: | SLX8 / 856852 |
SGDID: | S000000918 |
Length: | 274 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 75 |
Identity: | 27/75 - (36%) |
Similarity: | 42/75 - (56%) |
Gaps: | 7/75 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 EELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLSDKTWRK---CPICYDAIHAGDLKSCTIEQ 269
::.:||||..||..|.:|.|||.:|.|||...:: |.:|.|: |.:|...:: ||...:..
Yeast 202 KDYRCPICFEPPETALMTLCGHVFCCPCLFQMVN-SSRTCRQFGHCALCRSKVY---LKDVRLII 262
Fly 270 LRDLQVGEKI 279
||..||.:|:
Yeast 263 LRKKQVKKKV 272
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2164 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1987 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.