DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12099 and F19G12.1

DIOPT Version :9

Sequence 1:NP_647623.1 Gene:CG12099 / 38181 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_508270.1 Gene:F19G12.1 / 184691 WormBaseID:WBGene00017609 Length:159 Species:Caenorhabditis elegans


Alignment Length:47 Identity:16/47 - (34%)
Similarity:20/47 - (42%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 CPICL--YP---PVAAKLTRCGHAYCWPCLLHYLSLSDKTWRKCPIC 253
            |.:||  |.   |...|:..|.|.||..| :..:|.......|||.|
 Worm    95 CAVCLDSYASRGPKKPKVFSCLHTYCDAC-IREISSRHNGEMKCPEC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 15/45 (33%)
F19G12.1NP_508270.1 DivIC <25..>73 CDD:386109
RING-HC finger (C3HC4-type) 95..140 CDD:319361 15/45 (33%)
RING_Ubox 95..140 CDD:388418 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373540at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.