powered by:
Protein Alignment CG12099 and F19G12.1
DIOPT Version :9
Sequence 1: | NP_647623.1 |
Gene: | CG12099 / 38181 |
FlyBaseID: | FBgn0035232 |
Length: | 708 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508270.1 |
Gene: | F19G12.1 / 184691 |
WormBaseID: | WBGene00017609 |
Length: | 159 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
Similarity: | 20/47 - (42%) |
Gaps: | 6/47 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 CPICL--YP---PVAAKLTRCGHAYCWPCLLHYLSLSDKTWRKCPIC 253
|.:|| |. |...|:..|.|.||..| :..:|.......|||.|
Worm 95 CAVCLDSYASRGPKKPKVFSCLHTYCDAC-IREISSRHNGEMKCPEC 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1373540at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.