DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12099 and Y38F1A.2

DIOPT Version :9

Sequence 1:NP_647623.1 Gene:CG12099 / 38181 FlyBaseID:FBgn0035232 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_496760.1 Gene:Y38F1A.2 / 174939 WormBaseID:WBGene00012606 Length:283 Species:Caenorhabditis elegans


Alignment Length:84 Identity:22/84 - (26%)
Similarity:36/84 - (42%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 RSGAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLS 243
            |:.::...|...:.:|....|.:...|::.|  |||||.......||.|||.:|..|::.|    
 Worm    74 RAASRMDENAERNQIITQRRISEALHQSSHE--CPICLANASFPVLTDCGHIFCCECIIQY---- 132

  Fly   244 DKTWRK---------CPIC 253
               |::         |.:|
 Worm   133 ---WQQSKAIVTPCDCAMC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12099NP_647623.1 zf-C3HC4_2 212..253 CDD:290634 15/49 (31%)
Y38F1A.2NP_496760.1 RING-HC_RNF170 105..149 CDD:319467 16/51 (31%)
DUF1232 <232..275 CDD:382484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1987
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.