powered by:
Protein Alignment CG12099 and Y38F1A.2
DIOPT Version :9
Sequence 1: | NP_647623.1 |
Gene: | CG12099 / 38181 |
FlyBaseID: | FBgn0035232 |
Length: | 708 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496760.1 |
Gene: | Y38F1A.2 / 174939 |
WormBaseID: | WBGene00012606 |
Length: | 283 |
Species: | Caenorhabditis elegans |
Alignment Length: | 84 |
Identity: | 22/84 - (26%) |
Similarity: | 36/84 - (42%) |
Gaps: | 18/84 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 RSGAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYLSLS 243
|:.::...|...:.:|....|.:...|::.| |||||.......||.|||.:|..|::.|
Worm 74 RAASRMDENAERNQIITQRRISEALHQSSHE--CPICLANASFPVLTDCGHIFCCECIIQY---- 132
Fly 244 DKTWRK---------CPIC 253
|:: |.:|
Worm 133 ---WQQSKAIVTPCDCAMC 148
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2164 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1987 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.