DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and ECT1

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_011521.1 Gene:ECT1 / 852890 SGDID:S000003239 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:60/186 - (32%)
Similarity:89/186 - (47%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RVYADGIYDLFHQGHARQLMQAKNVF--PNVYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHCR 142
            :|:.||.:|..|.|||..::||:...  .|..|..||..||.....||..|||..||||..|..|
Yeast     9 KVWIDGCFDFTHHGHAGAILQARRTVSKENGKLFCGVHTDEDIQHNKGTPVMNSSERYEHTRSNR 73

  Fly   143 YVDEIVPNAPWTLNEEFIEEHKIDFVAH-DDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSD 206
            :..|:|..||:..:..::::::..:|.| |||...|.| .|.|..:|..|.|...:||.||||::
Yeast    74 WCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANG-EDCYKLVKEMGRFKVVKRTYGVSTTE 137

  Fly   207 IVARIVKDY-------DVYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKTRG 255
            |:.||:...       |.|........||..:   ..:|:..:..|..:|.:...|
Yeast   138 IIHRILTKKSLPPTHPDYYPTTQELSFYSVAQ---DAVSKHCYVFQRDLDNVLVNG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 60/186 (32%)
CCT 77..226 CDD:173925 54/155 (35%)
ECT1NP_011521.1 CCT 6..157 CDD:173925 53/148 (36%)
PTZ00308 9..321 CDD:140329 60/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.