DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and CCT1

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_180785.1 Gene:CCT1 / 817786 AraportID:AT2G32260 Length:332 Species:Arabidopsis thaliana


Alignment Length:283 Identity:133/283 - (46%)
Similarity:184/283 - (65%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TTRRVRVYADGIYDLFHQGHARQLMQAKNVFP-NVYLIVGVCNDELTLRMKGRTVMNGFERYEAV 138
            |.|.|||||||||||||.||||.|.|||..|| |.||:||.||||.|.:.||||||...||||::
plant    31 TDRPVRVYADGIYDLFHFGHARSLEQAKLAFPNNTYLLVGCCNDETTHKYKGRTVMTAEERYESL 95

  Fly   139 RHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAHDDIPY----GAGGVNDIYAPLKAKGMFVATERT 199
            |||::|||::|:|||.:|:||:::|:||:||||.:||    |||  .|:|..:|..|.|..|:||
plant    96 RHCKWVDEVIPDAPWVVNQEFLDKHQIDYVAHDSLPYADSSGAG--KDVYEFVKKVGRFKETQRT 158

  Fly   200 EGVSTSDIVARIVKDYDVYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKTRGKRELTKVKV 264
            ||:|||||:.||||||:.||.|||.||||.::|.|||:.||:.|:..::.:|:.|.|.:..:|..
plant   159 EGISTSDIIMRIVKDYNQYVMRNLDRGYSREDLGVSFVKEKRLRVNMRLKKLQERVKEQQERVGE 223

  Fly   265 DIIT------KWEEKSREFIDAFLLLF--GRERLNTFWNES-KGRIIQALSPPGSPNGSVNGDDP 320
            .|.|      :|.|.:..::..||.:|  |..::.|...:| :.|:::..|.....||.      
plant   224 KIQTVKMLRNEWVENADRWVAGFLEIFEEGCHKMGTAIVDSIQERLMRQKSAERLENGQ------ 282

  Fly   321 DATDDLDSEDEYMELPPDYGSGS 343
               || |::|::.|...|:..||
plant   283 ---DD-DTDDQFYEEYFDHDMGS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 129/272 (47%)
CCT 77..226 CDD:173925 95/153 (62%)
CCT1NP_180785.1 PLN02413 26..293 CDD:215229 129/273 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I1110
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I1093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm1135
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X834
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.920

Return to query results.
Submit another query.