DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and Pcyt2

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_077191.2 Gene:Pcyt2 / 68671 MGIID:1915921 Length:404 Species:Mus musculus


Alignment Length:137 Identity:58/137 - (42%)
Similarity:82/137 - (59%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHC 141
            |.|||:.||.||:.|.||:.||.||:.:  ..||||||..||...:.||..|....|||:.|:..
Mouse    21 RIVRVWCDGCYDMVHYGHSNQLRQARAM--GDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAI 83

  Fly   142 RYVDEIVPNAPWTLNEEFIEEHKIDFVAH-DDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTS 205
            ::|||:||.||:....|.:::|..||..| :||.....| .|.|..:|..|.:...:||:||||:
Mouse    84 KWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDG-RDTYEEVKQAGRYRECKRTQGVSTT 147

  Fly   206 DIVARIV 212
            |:|.|::
Mouse   148 DLVGRML 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 58/137 (42%)
CCT 77..226 CDD:173925 58/137 (42%)
Pcyt2NP_077191.2 PTZ00308 15..390 CDD:140329 58/137 (42%)
CCT 21..163 CDD:173925 58/137 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..201
ECT 230..382 CDD:173924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.