DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and pcyt2

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001006037.1 Gene:pcyt2 / 450016 ZFINID:ZDB-GENE-041010-132 Length:397 Species:Danio rerio


Alignment Length:140 Identity:58/140 - (41%)
Similarity:82/140 - (58%) Gaps:4/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KTTRRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRTVMNGFERYEAV 138
            |..|.:||:.||.||:.|.||:.||.|||.:  ..||:|||..||...:.||..|....|||:.:
Zfish    26 KRKRVIRVWCDGCYDMVHYGHSNQLRQAKAM--GDYLVVGVHTDEEIAKHKGPPVFTQAERYKMI 88

  Fly   139 RHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAH-DDIPYGAGGVNDIYAPLKAKGMFVATERTEGV 202
            |..::|||||..||:....|.::::..||..| |||.....| .|.|..:|..|.:...:||:||
Zfish    89 RAIKWVDEIVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDG-KDTYDEVKRTGRYRECKRTQGV 152

  Fly   203 STSDIVARIV 212
            ||:|:|.|::
Zfish   153 STTDLVGRML 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 57/139 (41%)
CCT 77..226 CDD:173925 57/137 (42%)
pcyt2NP_001006037.1 PTZ00308 20..374 CDD:140329 58/140 (41%)
CCT 29..173 CDD:173925 57/137 (42%)
ECT 219..371 CDD:173924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.