DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and Pcyt1b

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_775174.2 Gene:Pcyt1b / 286936 RGDID:708434 Length:369 Species:Rattus norvegicus


Alignment Length:329 Identity:170/329 - (51%)
Similarity:217/329 - (65%) Gaps:34/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DDES----PVSTAPATPTSPMEFKMLPLFMDFED------FSICQPAPFSYDDKAMLELERCDYT 62
            |.||    |.|.:...|:..||        :.|.      .::..||||:.:.....:...    
  Rat     7 DAESETGIPKSLSNEPPSETME--------EIEHTCPQPRLTLTAPAPFADESSCQCQAPH---- 59

  Fly    63 QRITYHMARAG-KTTRRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGR 126
            :::|...||.| ...|.||||||||:||||.||||.|||||.:|||.||:||||:|:||.:.||.
  Rat    60 EKLTIAQARLGTPVDRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGF 124

  Fly   127 TVMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPLKAKG 191
            ||||..|||||:||||||||::.:|||||..||:|:|||||||||||||.:.|.:|:|..:|..|
  Rat   125 TVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAG 189

  Fly   192 MFVATERTEGVSTSDIVARIVKDYDVYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELK---- 252
            |||.|:||||:|||||:.|||:|||||.||||.|||:||||||||::|||:|.||::|::|    
  Rat   190 MFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYRFQNQVDKMKEKVK 254

  Fly   253 ---TRGKRELTKVKV---DIITKWEEKSREFIDAFLLLFGRE-RLNTFWNESKGRIIQALSPPGS 310
               .|.|..:.:|:.   |:|.||||||||||..||.|||.: .....:.|...|::|||||..|
  Rat   255 NVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQS 319

  Fly   311 PNGS 314
            |..|
  Rat   320 PVSS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 153/251 (61%)
CCT 77..226 CDD:173925 104/148 (70%)
Pcyt1bNP_775174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 6/19 (32%)
PLN02413 72..314 CDD:215229 146/241 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..369 9/15 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340081
Domainoid 1 1.000 204 1.000 Domainoid score I2847
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 331 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm9063
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X834
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.