DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and pcyt-2.2

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001041226.2 Gene:pcyt-2.2 / 181047 WormBaseID:WBGene00016531 Length:361 Species:Caenorhabditis elegans


Alignment Length:213 Identity:57/213 - (26%)
Similarity:85/213 - (39%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPMEFK--MLPLFMDFEDFSICQPAPFSYDDKAMLELERCDYTQRITYHMARAGKTTRRVRVYAD 84
            |.::||  :||..:|          |.|.:....:.|.:.:||..... :.|..|.|.:| ||..
 Worm   161 SILDFKSAILPFALD----------PLSNEPVISVSLFKQNYTFAPVV-IGRKPKVTDKV-VYVS 213

  Fly    85 GIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGR--TVMNGFERYEAVRHCRYVDEI 147
            |.:||||.||...|..||::  ..|||||:..|:.....||.  .|||..||...:...:.|||:
 Worm   214 GAFDLFHAGHLSFLEAAKDL--GDYLIVGIVGDDDVNEEKGTIFPVMNLLERTLNISSLKIVDEV 276

  Fly   148 VPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARIV 212
            ....|...|.:|:...:...:|             :|:....:       |....:...|:..:.
 Worm   277 FVGVPAVTNSKFVNLIRASKIA-------------VYSETHPR-------RFADCTYHRIIEEVT 321

  Fly   213 KDYDVYVRRNLARGYSAK 230
            .|||......|.|..|.|
 Worm   322 PDYDATCEEILERITSRK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 44/158 (28%)
CCT 77..226 CDD:173925 40/150 (27%)
pcyt-2.2NP_001041226.2 PTZ00308 19..>284 CDD:140329 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.