DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt2 and Pcyt1a

DIOPT Version :9

Sequence 1:NP_647622.1 Gene:Pcyt2 / 38180 FlyBaseID:FBgn0035231 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_511177.2 Gene:Pcyt1a / 140544 RGDID:70515 Length:367 Species:Rattus norvegicus


Alignment Length:285 Identity:165/285 - (57%)
Similarity:207/285 - (72%) Gaps:16/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QPAPFSYDDKAMLELERCDYTQRITYHMARAGKTTRR-VRVYADGIYDLFHQGHARQLMQAKNVF 105
            ||||||.:    :|::......|:|...|..|....| ||||||||:||||.||||.||||||:|
  Rat    43 QPAPFSDE----IEVDFSKPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLF 103

  Fly   106 PNVYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAH 170
            ||.|||||||:||||...||.||||..|||:||:|||||||:|.||||||..||:.||:||||||
  Rat   104 PNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAH 168

  Fly   171 DDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARIVKDYDVYVRRNLARGYSAKELNVS 235
            |||||.:.|.:|:|..:|..|||..|:||||:|||||:.|||:|||||.||||.|||:|||||||
  Rat   169 DDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVS 233

  Fly   236 FLSEKKFRLQNKMDELKTRGK----------RELTKVKVDIITKWEEKSREFIDAFLLLFGRE-R 289
            |::|||:.||.::|::|.:.|          :::.:..:|:|.||||||||||.:||.:||.| .
  Rat   234 FINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGA 298

  Fly   290 LNTFWNESKGRIIQALSPPGSPNGS 314
            |.....|.|||::||:||..||:.|
  Rat   299 LKHMLKEGKGRMLQAISPKQSPSSS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt2NP_647622.1 PLN02413 75..334 CDD:215229 154/252 (61%)
CCT 77..226 CDD:173925 106/149 (71%)
Pcyt1aNP_511177.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CCT 75..224 CDD:173925 106/148 (72%)
Amphipathic. /evidence=ECO:0000255 228..287 26/58 (45%)
3 X 11 AA approximate tandem repeats 256..288 12/31 (39%)
Amphipathic. /evidence=ECO:0000255 298..315 7/16 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..367 6/11 (55%)
3 X repeats 319..348 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340083
Domainoid 1 1.000 204 1.000 Domainoid score I2847
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3680
Inparanoid 1 1.050 331 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm9063
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - LDO PTHR10739
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X834
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.