DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and PPM1F

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:280 Identity:62/280 - (22%)
Similarity:98/280 - (35%) Gaps:106/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VMGVADGVGGWRSY--------GIDPGEFSSFLMRTCERLVQCSHFN-------PQRPVNLLAYS 141
            :.|::|.|.  |:|        |:|...:::..:          |.|       |..|...|..:
Human   182 LFGLSDPVN--RAYFAVFDGHGGVDAARYAAVHV----------HTNAARQPELPTDPEGALREA 234

  Fly   142 YCE-----LMEQKKPILGSST--ACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HKSEE 194
            :..     |.:.|:..|.|.|  .|.||..   :|:|.|.:|||..::|::||||     |:.|.
Human   235 FRRTDQMFLRKAKRERLQSGTTGVCALIAG---ATLHVAWLGDSQVILVQQGQVVKLMEPHRPER 296

  Fly   195 QQHYFNTPFQLSLPPPG-----------HGPNVLSDSPESADTMSFPVRDG-------------D 235
            |..      :..:...|           :|  .|:.|....|....|...|             |
Human   297 QDE------KARIEALGGFVSHMDCWRVNG--TLAVSRAIGDVFQKPYVSGEADAASRALTGSED 353

  Fly   236 VILIATDGVFDNVPED----LMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALS 296
            .:|:|.||.||.||..    |:...|:..:|....|..::.|                      :
Human   354 YLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVA----------------------A 396

  Fly   297 ARRNNIQARGGKPDDITVVL 316
            ||..      |..|:|||::
Human   397 ARER------GSHDNITVMV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 62/278 (22%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 59/274 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.