Sequence 1: | NP_001261261.1 | Gene: | CG12091 / 38177 | FlyBaseID: | FBgn0035228 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009683.1 | Gene: | PTC4 / 852422 | SGDID: | S000000329 | Length: | 393 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 219 | Identity: | 42/219 - (19%) |
---|---|---|---|
Similarity: | 56/219 - (25%) | Gaps: | 115/219 - (52%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 KASTASADVMGVADGVGG--------------------------------WRSYGIDPGEFSSFL 116
Fly 117 ----------MRTCERLVQ--------------CSHFNPQRPVNLLAYSYCELMEQKKPILGSST 157
Fly 158 ACVLILNRETSTVHTANIGDSGFVVVREGQVVHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPE 222
Fly 223 SADTMSF---PVRDGDVILIATDG 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12091 | NP_001261261.1 | PP2Cc | 76..316 | CDD:294085 | 42/219 (19%) |
PTC4 | NP_009683.1 | PP2C | 82..355 | CDD:395385 | 37/207 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |