DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and PTC1

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_010278.3 Gene:PTC1 / 851558 SGDID:S000002164 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:38/200 - (19%)
Similarity:69/200 - (34%) Gaps:64/200 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ILGSS--TACVLILNRE---------------TSTVHTANIGDSGFVVVREGQVV-----HKSEE 194
            ::|:|  ||.|.:|..|               ...::|||:|||..|:.|.|..:     ||:.:
Yeast   108 LVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASD 172

  Fly   195 QQHYFNTPFQLSLPPPGHGPNVLSDSPESAD------------TMSFPVRDGDVILI-ATDGVFD 246
            ............|........:|:.:....|            |.|..:...|..|| |.||::|
Yeast   173 TLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWD 237

  Fly   247 NVPEDLMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDD 311
            .:.:....:::.::....:..|:                    |..:||         ..|..|:
Yeast   238 VIDDQDACELIKDITEPNEAAKV--------------------LVRYAL---------ENGTTDN 273

  Fly   312 ITVVL 316
            :||::
Yeast   274 VTVMV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 38/198 (19%)
PTC1NP_010278.3 PP2Cc 12..279 CDD:214625 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.