DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and PBCP

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_565696.1 Gene:PBCP / 817569 AraportID:AT2G30170 Length:298 Species:Arabidopsis thaliana


Alignment Length:301 Identity:95/301 - (31%)
Similarity:140/301 - (46%) Gaps:60/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PRPRFVSVVCGFAKDNLR----------------HKYKPGKYGEDSWFKASTASADVMGVADGVG 100
            |.|..|..:|..|...::                |..|..|.|||::| .|:....||.|||||.
plant    22 PNPSRVDFLCRCAPSEIQPLRPELSLSVGIHAIPHPDKVEKGGEDAFF-VSSYRGGVMAVADGVS 85

  Fly   101 GWRSYGIDPGEFSSFLMRTCERLVQCSHFNPQRPVNLLAYSYCELMEQKKPILGSSTACVLILNR 165
            ||....:||..||..||....|||...... ..|..|:..::.....:     ||:| .:|.:..
plant    86 GWAEQDVDPSLFSKELMANASRLVDDQEVR-YDPGFLIDKAHTATTSR-----GSAT-IILAMLE 143

  Fly   166 ETSTVHTANIGDSGFVVVREGQVVHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPESADT---M 227
            |...:...|:||.|..::||||::..:..|:|||:.|:|||             |..||.|   .
plant   144 EVGILKIGNVGDCGLKLLREGQIIFATAPQEHYFDCPYQLS-------------SEGSAQTYLDA 195

  Fly   228 SF---PVRDGDVILIATDGVFDNVPEDLMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEF 289
            ||   .|:.||||::.:||:||||.:.   :::|.|....|..:   ::..||.:|.:.|.::||
plant   196 SFSIVEVQKGDVIVMGSDGLFDNVFDH---EIVSIVTKHTDVAE---SSRLLAEVASSHSRDTEF 254

  Fly   290 LSPFALSARRNNI-----------QARGGKPDDITVVLATV 319
            .||:||.||....           :..|||.||:||::|.|
plant   255 ESPYALEARAKGFDVPLWKKVLGKKLTGGKLDDVTVIVAKV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 86/256 (34%)
PBCPNP_565696.1 PP2Cc 39..251 CDD:214625 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56397
OrthoDB 1 1.010 - - D826926at2759
OrthoFinder 1 1.000 - - FOG0002449
OrthoInspector 1 1.000 - - mtm1095
orthoMCL 1 0.900 - - OOG6_100742
Panther 1 1.100 - - LDO PTHR12320
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.